C1QT8_HUMAN P60827
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P60827
Recommended name：Complement C1q tumor necrosis factor-related protein 8
EC number：
Alternative names：(C1q/TNF-related protein 8) (CTRP8)
Cleaved into：
GeneID：390664
Gene names (primary )：C1QTNF8
Gene names (synonym )：
Gene names (ORF )：UNQ5829/PRO19648
Length：252
Mass：27685
Sequence：MAAPALLLLALLLPVGAWPGLPRRPCVHCCRPAWPPGPYARVSDRDLWRGDLWRGLPRVRPTIDIEILKGEKGEAGVRGRAGRSGKEGPPGARGLQGRRGQKGQVGPPGAACRRAYAAFSVGRREGLHSSDHFQAVPFDTELVNLDGAFDLAAGRFLCTVPGVYFLSLNVHTWNYKETYLHIMLNRRPAAVLYAQPSERSVMQAQSLMLLLAAGDAVWVRMFQRDRDNAIYGEHGDLYITFSGHLVKPAAEL
Tissue specificity：Expressed predominantly in lung and testis (PubMed:19666007). Expressed in astrocytes (PubMed:24014093). {ECO:0000269|PubMed:19666007, ECO:0000269|PubMed:24014093}.
Induction：
Developmental stage：
Protein families：