BD1L2_HUMAN   Q8IYS8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8IYS8

Recommended name:Biorientation of chromosomes in cell division protein 1-like 2

EC number:

Alternative names:(Biorientation of chromosomes in cell division protein 1 pseudogene) (Protein FAM44C)

Cleaved into:

GeneID:284257

Gene names  (primary ):BOD1L2

Gene names  (synonym ):BOD1P FAM44C

Gene names  (ORF ):

Length:172

Mass:18075

Sequence:MADGGGGGSGGAGPASTRASGGGGPINPASLPPGDPQLIAIIVGQLKSRGLFDSFRRDCKADVDTKPAYQNLSQKADNFVSTHLDKQEWNPPANDNQLHDGLRQSVVQSGRSEAGVDRISSQVVDPKLNHIFRPQIEQIIHEFLVAQKEAAVPALPPEPEGQDPPAPSQDTS

Tissue specificity:

Induction:

Developmental stage:

Protein families:BOD1 family


   💬 WhatsApp