DB124_HUMAN   Q8NES8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8NES8

Recommended name:Beta-defensin 124

EC number:

Alternative names:(Beta-defensin 24) (DEFB-24) (Defensin, beta 124)

Cleaved into:

GeneID:245937

Gene names  (primary ):DEFB124

Gene names  (synonym ):DEFB24

Gene names  (ORF ):

Length:71

Mass:8058

Sequence:MTQLLLFLVALLVLGHVPSGRSEFKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYALKPPPVPKHEYE

Tissue specificity:

Induction:

Developmental stage:

Protein families:Beta-defensin family


   💬 WhatsApp