VCY1_HUMAN   O14598


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O14598

Recommended name:Testis-specific basic protein Y 1

EC number:

Alternative names:(Basic charge, Y-linked 1) (Variably charged protein Y)

Cleaved into:

GeneID:353513

Gene names  (primary ):VCY; VCY1B

Gene names  (synonym ):BPY1 VCY1A; BPY1B

Gene names  (ORF ):;

Length:125

Mass:12917

Sequence:MSPKPRASGPPAKAKETGKRKSSSQPSPSGPKKKTTKVAEKGEAVRGGRRGKKGAATKMAAVTAPEAESGPAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLSQESELEEPLSKGRPSTPLSP

Tissue specificity:Expressed exclusively in testis.

Induction:

Developmental stage:

Protein families:VCX/VCY family


   💬 WhatsApp