XCL1_HUMAN P47992
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P47992
Recommended name：Lymphotactin
EC number：
Alternative names：(ATAC) (C motif chemokine 1) (Cytokine SCM-1) (Lymphotaxin) (SCM-1-alpha) (Small-inducible cytokine C1) (XC chemokine ligand 1)
Cleaved into：
GeneID：6375
Gene names (primary )：XCL1
Gene names (synonym )：LTN SCYC1
Gene names (ORF )：
Length：114
Mass：12517
Sequence：MRLLILALLGICSLTAYIVEGVGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
Tissue specificity：Highest level in spleen, lower in peripheral leukocytes and very low levels in lung, colon and small intestine.
Induction：
Developmental stage：
Protein families：Intercrine gamma family