ABRAL_HUMAN   Q9P1F3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9P1F3

Recommended name:Costars family protein ABRACL

EC number:

Alternative names:(ABRA C-terminal-like protein)

Cleaved into:

GeneID:58527

Gene names  (primary ):ABRACL

Gene names  (synonym ):C6orf115

Gene names  (ORF ):HSPC280 PRO2013

Length:81

Mass:9056

Sequence:MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVTYPGELLLQGVHDDVDIILLQD

Tissue specificity:

Induction:

Developmental stage:

Protein families:Costars family


   💬 WhatsApp