ETD_MOUSE   Q80SW5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q80SW5

Recommended name:Embryonic testis differentiation protein

EC number:

Alternative names:

Cleaved into:

GeneID:

Gene names  (primary ):Etd

Gene names  (synonym ):

Gene names  (ORF ):

Length:59

Mass:6981

Sequence:MDEKNPEAVPRPPEQNTELVPPKKSKSKKPANILIYLIDRHLGRPRNDMDLFEWVWTLK

Tissue specificity:Specifically expressed in testis. {ECO:0000269|PubMed:12617826}.

Induction:

Developmental stage:Not detected at 9.5 dpc and 10.5 dpc. Specifically expressed in male and not female gonads during their differentiation, from 12.5 dpc to 14.5 dpc. {ECO:0000269|PubMed:12617826}.

Protein families:


   💬 WhatsApp