FAHD1_HUMAN   Q6P587


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6P587

Recommended name:Acylpyruvase FAHD1, mitochondrial

EC number:EC:3.7.1.5

Alternative names:(Fumarylacetoacetate hydrolase domain-containing protein 1) (FAH domain-containing protein 1) (Oxaloacetate decarboxylase) (OAA decarboxylase) (YisK-like protein)

Cleaved into:

GeneID:81889

Gene names  (primary ):FAHD1

Gene names  (synonym ):C16orf36 YISKL

Gene names  (ORF ):

Length:224

Mass:24843

Sequence:MGIMAASRPLSRFWEWGKNIVCVGRNYADHVREMRSAVLSEPVLFLKPSTAYAPEGSPILMPAYTRNLHHELELGVVMGKRCRAVPEAAAMDYVGGYALCLDMTARDVQDECKKKGLPWTLAKSFTASCPVSAFVPKEKIPDPHKLKLWLKVNGELRQEGETSSMIFSIPYIISYVSKIITLEEGDIILTGTPKGVGPVKENDEIEAGIHGLVSMTFKVEKPEY

Tissue specificity:Ubiquitous (at protein level). {ECO:0000269|PubMed:21878618}.

Induction:

Developmental stage:

Protein families:FAH family


   💬 WhatsApp