DTD2_HUMAN   Q96FN9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96FN9

Recommended name:D-aminoacyl-tRNA deacylase 2

EC number:EC:3.1.1.96

Alternative names:(Animalia-specific tRNA deacylase) (ATD) (D-tyrosyl-tRNA(Tyr) deacylase 2) (L-alanyl-tRNA deacylase)

Cleaved into:

GeneID:112487

Gene names  (primary ):DTD2

Gene names  (synonym ):C14orf126

Gene names  (ORF ):

Length:168

Mass:18660

Sequence:MAEGSRIPQARALLQQCLHARLQIRPADGDVAAQWVEVQRGLVIYVCFFKGADKELLPKMVNTLLNVKLSETENGKHVSILDLPGNILIIPQATLGGRLKGRNMQYHSNSGKEEGFELYSQFVTLCEKEVAANSKCAEARVVVEHGTYGNRQVLKLDTNGPFTHLIEF

Tissue specificity:

Induction:

Developmental stage:

Protein families:DTD family


   💬 WhatsApp