ADPPT_HUMAN   Q9NRN7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NRN7

Recommended name:L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase

EC number:EC:2.7.8.7

Alternative names:(4'-phosphopantetheinyl transferase) (Alpha-aminoadipic semialdehyde dehydrogenase-phosphopantetheinyl transferase) (AASD-PPT) (LYS5 ortholog)

Cleaved into:

GeneID:60496

Gene names  (primary ):AASDHPPT

Gene names  (synonym ):

Gene names  (ORF ):CGI-80 HAH-P HSPC223 x0005

Length:309

Mass:35776

Sequence:MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPVLAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGFELQRLEFDLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTKS

Tissue specificity:Detected in heart, skeletal muscle, placenta, testis, brain, pancreas, liver and kidney. {ECO:0000269|PubMed:11286508, ECO:0000269|PubMed:12815048}.

Induction:

Developmental stage:

Protein families:P-Pant transferase superfamily, AcpS family