ELOV6_HUMAN Q9H5J4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9H5J4
Recommended name：Elongation of very long chain fatty acids protein 6
EC number：EC:2.3.1.199
Alternative names：(3-keto acyl-CoA synthase ELOVL6) (ELOVL fatty acid elongase 6) (ELOVL FA elongase 6) (Fatty acid elongase 2) (hELO2) (Fatty acyl-CoA elongase) (Long-chain fatty-acyl elongase) (Very long chain 3-ketoacyl-CoA synthase 6) (Very long chain 3-oxoacyl-CoA synthase 6)
Cleaved into：
GeneID：79071
Gene names (primary )：ELOVL6
Gene names (synonym )：FACE LCE
Gene names (ORF )：
Length：265
Mass：31376
Sequence：MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE
Tissue specificity：Ubiquitous. {ECO:0000269|PubMed:20937905}.
Induction：
Developmental stage：
Protein families：ELO family, ELOVL6 subfamily