DHB3_HUMAN P37058
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P37058
Recommended name：Testosterone 17-beta-dehydrogenase 3
EC number：EC:1.1.1.64
Alternative names：(17-beta-hydroxysteroid dehydrogenase type 3) (17-beta-HSD 3) (Estradiol 17-beta-dehydrogenase 2) (Short chain dehydrogenase/reductase family 12C member 2) (Testicular 17-beta-hydroxysteroid dehydrogenase)
Cleaved into：
GeneID：3293
Gene names (primary )：HSD17B3
Gene names (synonym )：EDH17B3 SDR12C2
Gene names (ORF )：
Length：310
Mass：34516
Sequence：MGDVLEQFFILTGLLVCLACLAKCVRFSRCVLLNYWKVLPKSFLRSMGQWAVITGAGDGIGKAYSFELAKRGLNVVLISRTLEKLEAIATEIERTTGRSVKIIQADFTKDDIYEHIKEKLAGLEIGILVNNVGMLPNLLPSHFLNAPDEIQSLIHCNITSVVKMTQLILKHMESRQKGLILNISSGIALFPWPLYSMYSASKAFVCAFSKALQEEYKAKEVIIQVLTPYAVSTAMTKYLNTNVITKTADEFVKESLNYVTIGGETCGCLAHEILAGFLSLIPAWAFYSGAFQRLLLTHYVAYLKLNTKVR
Tissue specificity：Testis. {ECO:0000269|PubMed:8075637}.
Induction：
Developmental stage：
Protein families：Short-chain dehydrogenases/reductases (SDR) family, 17-beta-HSD 3 subfamily