HSPB8_HUMAN Q9UJY1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9UJY1
Recommended name：Heat shock protein beta-8
EC number：
Alternative names：(HspB8) (Alpha-crystallin C chain) (E2-induced gene 1 protein) (Protein kinase H11) (Small stress protein-like protein HSP22)
Cleaved into：
GeneID：26353
Gene names (primary )：HSPB8
Gene names (synonym )：CRYAC E2IG1 HSP22
Gene names (ORF )：PP1629
Length：196
Mass：21604
Sequence：MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT
Tissue specificity：Predominantly expressed in skeletal muscle and heart. {ECO:0000269|PubMed:11470154}.
Induction：By 17-beta-estradiol.
Developmental stage：
Protein families：Small heat shock protein (HSP20) family