DEXI_HUMAN O95424
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O95424
Recommended name：Dexamethasone-induced protein
EC number：
Alternative names：(Protein MYLE)
Cleaved into：
GeneID：28955
Gene names (primary )：DEXI
Gene names (synonym )：MYLE
Gene names (ORF )：
Length：95
Mass：10429
Sequence：MLGARVAAHLDALGPLVPYVPPPLLPSMFYVGLFFVNVLILYYAFLMEYIVLNVGLVFLPEDMDQALVDLGVLSDPGSGLYDADSELDVFDAYLE
Tissue specificity：Highest levels in heart. Also expressed in brain, liver, pancreas, placenta and lung. Up-regulated in emphysematous lung compared to normal lung. {ECO:0000269|PubMed:11472984}.
Induction：By dexamethasone. {ECO:0000269|PubMed:11472984}.
Developmental stage：
Protein families：DEXI family