MK_HUMAN P21741
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P21741
Recommended name：Midkine
EC number：
Alternative names：(MK) (Amphiregulin-associated protein) (ARAP) (Midgestation and kidney protein) (Neurite outgrowth-promoting factor 2) (Neurite outgrowth-promoting protein)
Cleaved into：
GeneID：4192
Gene names (primary )：MDK
Gene names (synonym )：MK1 NEGF2
Gene names (ORF )：
Length：143
Mass：15585
Sequence：MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD
Tissue specificity：Expressed in various tumor cell lines. In insulinoma tissue predominantly expressed in precancerous lesions. {ECO:0000269|PubMed:17379400}.
Induction：By heparin and retinoic acid. {ECO:0000269|PubMed:1768439, ECO:0000269|PubMed:8241100}.
Developmental stage：
Protein families：Pleiotrophin family