PHLA3_HUMAN Q9Y5J5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Y5J5
Recommended name：Pleckstrin homology-like domain family A member 3
EC number：
Alternative names：(TDAG51/Ipl homolog 1)
Cleaved into：
GeneID：23612
Gene names (primary )：PHLDA3
Gene names (synonym )：TIH1
Gene names (ORF )：
Length：127
Mass：13891
Sequence：MTAAATATVLKEGVLEKRSGGLLQLWKRKRCVLTERGLQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVRARQSLGTGTLVS
Tissue specificity：Widely expressed with lowest expression in liver and spleen. {ECO:0000269|PubMed:10594239}.
Induction：By p53/TP53; expression is directly activated by TP53. TP53 phosphorylation on 'Ser-15' is required to activate the PHLDA3 promoter. {ECO:0000269|PubMed:15940259, ECO:0000269|PubMed:19203586}.
Developmental stage：
Protein families：PHLDA3 family