AR6P1_HUMAN Q15041
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q15041
Recommended name：ADP-ribosylation factor-like protein 6-interacting protein 1
EC number：
Alternative names：(ARL-6-interacting protein 1) (Aip-1) (Apoptotic regulator in the membrane of the endoplasmic reticulum)
Cleaved into：
GeneID：23204
Gene names (primary )：ARL6IP1
Gene names (synonym )：ARL6IP ARMER KIAA0069
Gene names (ORF )：
Length：203
Mass：23363
Sequence：MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNE
Tissue specificity：Expressed in all hematopoietic cell lineages, but the highest level of expression is found in early myeloid progenitor cells. Expressed in brain, bone marrow, thymus and lung. Expressed at low level in liver, kidney and spleen. Not detected in heart. {ECO:0000269|PubMed:10995579}.
Induction：Down-regulated by apoptotic stimuli. {ECO:0000269|PubMed:12754298}.
Developmental stage：Down-regulated during myeloid differentiation.
Protein families：ARL6ip family