HMGA2_HUMAN   P52926


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P52926

Recommended name:High mobility group protein HMGI-C

EC number:

Alternative names:(High mobility group AT-hook protein 2)

Cleaved into:

GeneID:8091

Gene names  (primary ):HMGA2

Gene names  (synonym ):HMGIC

Gene names  (ORF ):

Length:109

Mass:11832

Sequence:MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEATGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED

Tissue specificity:

Induction:

Developmental stage:Expressed predominantly during embryogenesis.

Protein families:HMGA family


   💬 WhatsApp