H33_HUMAN   P84243


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P84243

Recommended name:Histone H3.3

EC number:

Alternative names:

Cleaved into:

GeneID:3020

Gene names  (primary ):H3-3A; H3-3B

Gene names  (synonym ):H3.3A H3F3 H3F3A; H3.3B H3F3B

Gene names  (ORF ):PP781;

Length:136

Mass:15328

Sequence:MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Tissue specificity:

Induction:

Developmental stage:Expressed throughout the cell cycle independently of DNA synthesis.

Protein families:Histone H3 family


   💬 WhatsApp