TSPO2_HUMAN   Q5TGU0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5TGU0

Recommended name:Translocator protein 2

EC number:

Alternative names:(Peripheral-type benzodiazepine receptor-like protein 1)

Cleaved into:

GeneID:222642

Gene names  (primary ):TSPO2

Gene names  (synonym ):BZRPL1

Gene names  (ORF ):

Length:170

Mass:19129

Sequence:MRLQGAIFVLLPHLGPILVWLFTRDHMSGWCEGPRMLSWCPFYKVLLLVQTAIYSVVGYASYLVWKDLGGGLGWPLALPLGLYAVQLTISWTVLVLFFTVHNPGLALLHLLLLYGLVVSTALIWHPINKLAALLLLPYLAWLTVTSALTYHLWRDSLCPVHQPQPTEKSD

Tissue specificity:Expressed in erythrocytes (at protein level). {ECO:0000269|PubMed:27641616}.

Induction:

Developmental stage:Expression levels increase during erythrocyte differentiation. {ECO:0000269|PubMed:27641616}.

Protein families:TspO/BZRP family


   💬 WhatsApp