CLC11_HUMAN Q9Y240
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Y240
Recommended name：C-type lectin domain family 11 member A
EC number：
Alternative names：(C-type lectin superfamily member 3) (Lymphocyte secreted C-type lectin) (Osteolectin) (Stem cell growth factor) (p47)
Cleaved into：
GeneID：6320
Gene names (primary )：CLEC11A
Gene names (synonym )：CLECSF3 LSLCL SCGF
Gene names (ORF )：
Length：323
Mass：35695
Sequence：MQAAWLLGALVVPQLLGFGHGARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAGRGDENPAGTVEGKEDWEMEEDQGEEEEEEATPTPSSGPSPSPTPEDIVTYILGRLAGLDAGLHQLHVRLHALDTRVVELTQGLRQLRNAAGDTRDAVQALQEAQGRAEREHGRLEGCLKGLRLGHKCFLLSRDFEAQAAAQARCTARGGSLAQPADRQQMEALTRYLRAALAPYNWPVWLGVHDRRAEGLYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF
Tissue specificity：Expressed in skeletal tissues including bone marrow, chondrocytes, primary ossification center-associated cells, the perichondrium and periosteum. Lower levels of expression were detected in spleen, thymus, appendix and fetal liver. {ECO:0000269|PubMed:11803813, ECO:0000269|PubMed:11920266, ECO:0000269|PubMed:9442024, ECO:0000269|PubMed:9705843}.
Induction：
Developmental stage：In the bone marrow, expression is limited to immature neutrophils. Expression was not detected in circulating mature neutrophils. {ECO:0000269|PubMed:11803813}.
Protein families：