BOK_HUMAN Q9UMX3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9UMX3
Recommended name：Bcl-2-related ovarian killer protein
EC number：
Alternative names：(hBOK) (Bcl-2-like protein 9) (Bcl2-L-9)
Cleaved into：
GeneID：666
Gene names (primary )：BOK
Gene names (synonym )：BCL2L9
Gene names (ORF )：
Length：212
Mass：23280
Sequence：MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERAAPVPGRLAEVCAVLLRLGDELEMIRPSVYRNVARQLHISLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRFLKAAFFVLLPER
Tissue specificity：Expressed mainly in oocytes; weak expression in granulosa cells of the developing follicles. In adult human ovaries, expressed in granulosa cells at all follicular stages, but expression in primordial/primary follicles granulosa cell is stronger than in secondary and antral follicles. {ECO:0000269|PubMed:20673843}.
Induction：Up-regulated by DNA damage. {ECO:0000269|PubMed:15102863}.
Developmental stage：Isoform 1: at 5-7 weeks of gestation, detected primarily in the cytotrophoblast layer. By 10-13 weeks, expression becomes restricted primarily to the apical border of the syncytiotrophoblast (PubMed:19942931). Isoform 2: expression significantly increased around 6-8 weeks (PubMed:15775999). {ECO:0000269|PubMed:15775999, ECO:0000269|PubMed:19942931}.
Protein families：Bcl-2 family