TM121_HUMAN   Q9BTD3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BTD3

Recommended name:Transmembrane protein 121

EC number:

Alternative names:

Cleaved into:

GeneID:80757

Gene names  (primary ):TMEM121

Gene names  (synonym ):HHOLE

Gene names  (ORF ):

Length:319

Mass:35814

Sequence:MVLPPPDRRHVCLTTLVIMGSMAVMDAYLVEQNQGPRKIGVCIIVLVGDVCFLLVLRYVAVWVGAEVRTAKRGYAMILWFLYIFVLEIKLYFIFQNYKAARRGAADPVARKALTLLLSVCVPGLFLLLVALDRMEYVRTFRKREDLRGRLFWVALDLLDLLDMQASLWEPPRSGLPLWAEGLTFFYCYMLLLVLPCVALSEVSMQGEHIAPQKMMLYPVLSLATVNVVAVLARAANMALFRDSRVSAIFVGKNVVALATKACTFLEYRRQVRDFPPPALSLELQPPPPQRNSVPPPPPPLHGPPGRPHMSSPTRDPLDT

Tissue specificity:Highly expressed in heart and detected in pancreas, liver and skeletal muscle. {ECO:0000269|PubMed:15950185}.

Induction:

Developmental stage:Widely expressed in fetal tissues with high expression in fetal heart. {ECO:0000269|PubMed:15950185}.

Protein families:TMEM121 family


   💬 WhatsApp