XL3C_MOUSE   Q61806


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q61806

Recommended name:X-linked lymphocyte-regulated protein 3C

EC number:

Alternative names:(XLR-related protein A12)

Cleaved into:

GeneID:

Gene names  (primary ):Xlr3c

Gene names  (synonym ):Xlr3b

Gene names  (ORF ):

Length:226

Mass:26179

Sequence:MSSRKRKATDTAGRHSRMDPNLSSDDSQNPGAVAAANREVLDAGREDIISSGTERQQARKEKQDLVQEFEEPRNKVLQENREKFSRIMTSSFSAMEVKIKDVLKTHCEERQKLCQDYSLQFTNLNRKLTSDAYKLKKHAETLSNMFMEQQKFIHESLTLQKNRMEEFKSLCEKYLEKLEVLRDSRGNSIAEELRRLIATLEIKLLMLHNQQKTAAPPQSLLDVLFS

Tissue specificity:Expressed in lymphoid cells.

Induction:

Developmental stage:

Protein families:XLR/SYCP3 family


   💬 WhatsApp