XKR2_MOUSE   Q5GH68


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5GH68

Recommended name:XK-related protein 2

EC number:

Alternative names:(X Kell blood group-related, X-linked)

Cleaved into:

GeneID:331524

Gene names  (primary ):Xkrx

Gene names  (synonym ):Xkr2 Xrg2

Gene names  (ORF ):

Length:449

Mass:51778

Sequence:MDRVYEIPEEPNVVPISSLEEDVIRGPNPRFTFPFSILFSTFLYCGEAASALYMVRIYRKNNETFWMTYTFSFFMFSSIMVQLTLIFVHRDLAKDRPLSLFMHLILLGPVIRCLEAMIKYLTLWKKEGQEEPYVSLTRKKMLIAGQEVLIEWEVGHSIRTLAMHRNAYKRMSQIQAFLGSVPQLTYQLYVSLISAEVPLGRAVLMAFSLISVTYGATLCNMLAIQIKYDDYKIRLGPLEVLCITVWRTLEITSRLVILVLFSATLKLKAVPFLVLNFLIILFEPWVKFWRSGAQMPNNIEKNFSRVGTLVVLISVTILYAGINFSCWSAMQLKLADRDLVDKGQNWGHMGLHYSVRLVENVIMVLVFKYFGVKVLLNYCHSLIAVQLIIAYLISIGVMLLFFQYLHPLRSLFTNNVVDYLHCICCRRPRPERVENSETSCEADTTQSIV

Tissue specificity:

Induction:

Developmental stage:

Protein families:XK family


   💬 WhatsApp