FMO1_RAT P36365
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P36365
Recommended name：Flavin-containing monooxygenase 1 1 Publication
EC number：EC:1.14.13.148
Alternative names：Dimethylaniline monooxygenase [N-oxide-forming] 1 Dimethylaniline oxidase 1 Hepatic flavin-containing monooxygenase 1 (FMO 1) Trimethylamine monooxygenase
Cleaved into：
GeneID：25256
Gene names (primary )：Fmo1
Gene names (synonym )：Fmo-1 1 Publication
Gene names (ORF )：
Length：532
Mass：59,825
Sequence：MVKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSCDLGGLWRFTEHVEEGRASLYNSVVSNSSKEMSCYSDFPFPEDYPNFVPNSLFLEYLQLYATQFNLLRCIYFNTKVCSITKRPDFAVSGQWEVVTVCQGKQSSDTFDAVMVCTGFLTNPHLPLDSFPGIQTFKGQYFHSRQYKHPDVFKDKRVLVVGMGNSGTDIAVEASHLAKKVFLSTTGGAWVISRVFDSGYPWDMIFMTRFQNMLRNLLPTPVVSWLISKKMNSWFNHVNYGVAPEDRTQLREPVLNDELPGRIITGKVLIKPSIKEVKENSVVFNNTPKEEPIDVIVFATGYSFAFPFLDESIVKVEDGQASLYKYIFPAHLPKPTLAVIGLIKPLGSMIPTGETQARWVVQVLKGATTLPPPSVMMKEVNERKKNKHSGFGLCYCKALQSDYITYIDDLLTSINAKPDLRAMLLTDPRLALSIFFGPCTPYHFRLTGPGKWEGARKAILTQWDRTVNVTKTRTVQETPSTFETLLKLFSFLALLVAVFFIFL
Tissue specificity：Expressed in liver, lung and kidney and to a lesser extent in the heart and brain. 1
Induction：
Developmental stage：
Protein families：