TIFA_MOUSE   Q793I8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q793I8

Recommended name:TRAF-interacting protein with FHA domain-containing protein A

EC number:

Alternative names:(TRAF2-binding protein)

Cleaved into:

GeneID:211550

Gene names  (primary ):Tifa

Gene names  (synonym ):T2bp

Gene names  (ORF ):

Length:184

Mass:21560

Sequence:MSTFEDADTEETVTCLQMTIYHPGQQSGIFKSIRFCSKEKFPSIEVVKFGRNSNMCQYTFQDKQVSRIQFVLQPFKQFNSSVLSFEIKNMSKKTSLMVDNQELGYLNKMDLPYKCMLRFGEYQFLLQKEDGESVESFETQFIMSSRPLLQENNWPTQNPIPEDGMYSSYFTHRSSPSEMDENEL

Tissue specificity:Highly expressed in the spleen and at lower levels in heart, brain, lung, liver, kidney and testes. {ECO:0000269|PubMed:11798190, ECO:0000269|PubMed:12566447}.

Induction:

Developmental stage:

Protein families:TIFA family


   💬 WhatsApp