MMP11_MOUSE Q02853
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q02853
Recommended name：Stromelysin-3
EC number：EC 3.4.24.-
Alternative names：(SL-3) (ST3) (Matrix metalloproteinase-11) (MMP-11)
Cleaved into：
GeneID：17385
Gene names (primary )：Mmp11
Gene names (synonym )：
Gene names (ORF )：
Length：492
Mass：55441
Sequence：MARAACLLRAISRVLLLPLPLLLLLLLLLPSPLMARARPPESHRHHPVKKGPRLLHAALPNTLTSVPASHWVPSPAGSSRPLRCGVPDLPDVLNARNRQKRFVLSGGRWEKTDLTYRILRFPWQLVREQVRQTVAEALQVWSEVTPLTFTEVHEGRADIMIDFARYWHGDNLPFDGPGGILAHAFFPKTHREGDVHFDYDETWTIGDNQGTDLLQVAAHEFGHVLGLQHTTAAKALMSPFYTFRYPLSLSPDDRRGIQHLYGRPQMAPTSPAPTLSSQAGTDTNEIALLEPETPPDVCETSFDAVSTIRGELFFFKAGFVWRLRSGRLQPGYPALASRHWQGLPSPVDAAFEDAQGQIWFFQGAQYWVYDGEKPVLGPAPLSKLGLQGSPVHAALVWGPEKNKIYFFRGGDYWRFHPRTQRVDNPVPRRSTDWRGVPSEIDAAFQDAEGYAYFLRGHLYWKFDPVKVKVLEGFPRPVGPDFFDCAEPANTFR
Tissue specificity：Specifically expressed in the mammary gland during apoptosis.
Induction：
Developmental stage：
Protein families：Peptidase M10A family