NAA80_MOUSE   Q9R123


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9R123

Recommended name:N-alpha-acetyltransferase 80

EC number:EC 2.3.1.-

Alternative names:(N-acetyltransferase 6) (Protein fusion-2 homolog) (Protein fus-2)

Cleaved into:

GeneID:56441

Gene names  (primary ):Naa80

Gene names  (synonym ):Fus2 Nat6

Gene names  (ORF ):

Length:314

Mass:34583

Sequence:MELILSTSPAKLTLDPARQPELTLRFNLSKLTLDPARQPELSLSPRLAELTLDPTCHPEMSLSPGPAELTLDPQHQAKELPVPKLPELILEPVHCRPELMSACADLINDQWPRSRASRLHSLGQSSDAFPLCLMLLSPQPTPGAAPVVVGHARLSRVLDQPHSLLVETVVVARPLRGRGFGRRLMEGLEAFARARGFRRLHLTTHDQLYFYAHLGYQLGEPVQGLAFTNRRLSTTVLRAFSKPPCPQPPCKEPILAAQAVPRSSKGPPLPPPPPLPQSLTASPPPSPEPLPQSPLETCYRDLKGCPIFWMEKDI

Tissue specificity:

Induction:

Developmental stage:

Protein families:Acetyltransferase family


   💬 WhatsApp