CC1L1_MOUSE P51676
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P51676
Recommended name：C-C chemokine receptor 1-like protein 1
EC number：
Alternative names：(Macrophage inflammatory protein 1 alpha receptor-like 1)
Cleaved into：
GeneID：12770
Gene names (primary )：Ccr1l1
Gene names (synonym )：Cmkbr1l1
Gene names (ORF )：
Length：356
Mass：40849
Sequence：MEIPAVTEPSYNTVAKNDFMSGFLCFSINVRAFGITVLTPLYSLVFIIGVIGHVLVVLVLIQHKRLRNMTSIYLFNLAISDLVFLSTLPFWVDYIMKGDWIFGNAMCKFVSGFYYLGLYSDMFFITLLTIDRYLAVVHVVFALRARTVTFGIISSIITWVLAALVSIPCLYVFKSQMEFTYHTCRAILPRKSLIRFLRFQALTMNILGLILPLLAMIICYTRIINVLHRRPNKKKAKVMRLIFVITLLFFLLLAPYYLAAFVSAFEDVLFTPSCLRSQQVDLSLMITEALAYTHCCVNPVIYVFVGKRFRKYLWQLFRRHTAITLPQWLPFLSVDRAQRASATPPSTVEIETSADL
Tissue specificity：Detected in the spleen, liver and leukocytes.
Induction：
Developmental stage：
Protein families：G-protein coupled receptor 1 family