RN148_MOUSE   G3X9R7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:G3X9R7

Recommended name:RING finger protein 148

EC number:

Alternative names:(Goliath-related E3 ubiquitin-protein ligase 3)

Cleaved into:

GeneID:71300

Gene names  (primary ):Rnf148

Gene names  (synonym ):Greul3

Gene names  (ORF ):

Length:316

Mass:35463

Sequence:MLLCVSCLSVNGEMNPLGPTPSVHRSVSFWLLRLSVFLLLSLRDSKGKAIWTAHLNITFQVGNRIISELGESGVFGNHSPLERVSGAVVLPEGWNQNACSPLTNFSRPDQTDTWLALIERGGCTFTHKINLAAEKGANGVIIYNYPGTGNKVFPMSHQGTENIVAVMIGNLKGMELLHLIQQGVYVTIIIEVGRMHMPWLSHYVMSLFTFLAATVTYLFLYCAWRPRVSNSSTRRQRQLKADVKKAIGQLQLRVLQDGDKELDPNEDSCVVCFDMYKAQDVIRILTCKHFFHKTCIDPWLLAHRTCPMCKCDILKP

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp