SLX1_MOUSE   Q8BX32


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BX32

Recommended name:Structure-specific endonuclease subunit SLX1

EC number:EC 3.1.-.-

Alternative names:(GIY-YIG domain-containing protein 1)

Cleaved into:

GeneID:75764

Gene names  (primary ):Slx1b

Gene names  (synonym ):Giyd1 Giyd2 Slx1

Gene names  (ORF ):

Length:270

Mass:30656

Sequence:MDHAARPGRFFGVYLLYCQNPRHRGRVYVGFTVNPARRVRQHNAGRKKGGAWRTSGRGPWDMVLIIHGFPSAVAALRFEWAWQHPQASRRLTHVGPRLRSEAAFAFHLRVLAHMLRVPPWVRLPLTLRWLRPDFRHELCPAPPAHMPIAFGPPPPQPLVPKRPAVSEADSERQLDLGTKARCSLCARLLQDEEGPLCCPHPGCPLRAHIICLAEEFLQEEPGQLLPLEGHCPSCKKSLLWGNLVGQCHADTEEEEDLELEEEHWTDLLET

Tissue specificity:Expressed in testis, colon, bone marrow, brain, thymus and to a lesser extent in heart, kidney, skeletal muscle and spleen. {ECO:0000269|PubMed:27010503}.

Induction:

Developmental stage:

Protein families:SLX1 family


   💬 WhatsApp