UIF_MOUSE   Q91Z49


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q91Z49

Recommended name:UAP56-interacting factor

EC number:

Alternative names:(Forty-two-three domain-containing protein 1) (Protein 40-2-3)

Cleaved into:

GeneID:69823

Gene names  (primary ):Fyttd1

Gene names  (synonym ):Uif

Gene names  (ORF ):

Length:317

Mass:35887

Sequence:MNRFGTRLVGATATPPPPPKARSNENLDKIDMSLDDIIKLNRKEGKKQNFPRLNRRLQQSGTRQFRMRVRWGIQQNSGFGKTSLSRRGRVLPGKRRPYGVITGLAARKATGIRKGISPMNRPPLSDKNIERYFPALKRKTSLLRQNEVQRKQVAVLKRPNQLNRKNNIPANFTRNGNKLSHQKDTRQATFLFRRGLKVQTQLNTEQLIDDVVAKRTRQWRTSTTNGGILTVSIDNPGAVQCPVTQKPRLTRTAVPSFLTKREQSDVKKVPKGVPLQFDINSVGKQTGMTLNERFGILKEQRANLTFSKGGSRFVTVG

Tissue specificity:

Induction:

Developmental stage:

Protein families:UIF family


   💬 WhatsApp