APTX_MOUSE   Q7TQC5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q7TQC5

Recommended name:Aprataxin

EC number:EC 3.6.1.71

Alternative names:(Forkhead-associated domain histidine triad-like protein) (FHA-HIT)

Cleaved into:

GeneID:66408

Gene names  (primary ):Aptx

Gene names  (synonym ):

Gene names  (ORF ):

Length:342

Mass:38723

Sequence:MPEAVAKMRVCWLVRQDSRHQRIKLPHLEAVVIGRSPETKITDKKCSRQQVQLKAECNKGYVKVQQMGVNPTSIDSGVIGKDQEKKLLPGQVLHMVNGLYPYIVEFEEVAESPNLTQRKRKRSDCDSEEMEAESGTGLAPGSSPSQCSVSPKKDKNGATKKESLGHWSQGLKMSMKDPKMQVYKDDQVVVIKDKYPKARHHWLVLPWASISSLKVVTSEHLELLKHMHAVGEKVIADFAGSSKLRFRLGYHAIPSMSHVHLHVISQDFDSPCLKNKKHWNSFNTEYFLESQAVIKMVQEAGRVTVKDGTCELLKLPLRCHECQQLLPSIPQLKEHLRKHWGG

Tissue specificity:Widely expressed. Expressed in heart, liver, kidney, spleen, lung, muscle, brain stem, spinal cord, cerebellum and brain. {ECO:0000269|PubMed:11586300}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp