FGF23_MOUSE   Q9EPC2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9EPC2

Recommended name:Fibroblast growth factor 23

EC number:

Alternative names:(FGF-23)

Cleaved into:

GeneID:64654

Gene names  (primary ):Fgf23

Gene names  (synonym ):

Gene names  (ORF ):

Length:251

Mass:27758

Sequence:MLGTCLRLLVGVLCTVCSLGTARAYPDTSPLLGSNWGSLTHLYTATARTSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVITGAMTRRFLCMDLHGNIFGSLHFSPENCKFRQWTLENGYDVYLSQKHHYLVSLGRAKRIFQPGTNPPPFSQFLARRNEVPLLHFYTVRPRRHTRSAEDPPERDPLNVLKPRPRATPVPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARGGAGGADRCRPFPRFV

Tissue specificity:Mainly expressed in the brain and thymus at low levels. In brain; preferentially expressed in the ventrolateral thalamic nucleus.

Induction:

Developmental stage:

Protein families:Heparin-binding growth factors family


   💬 WhatsApp