FABPI_MOUSE P55050
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P55050
Recommended name：Fatty acid-binding protein, intestinal
EC number：
Alternative names：(Fatty acid-binding protein 2) (Intestinal-type fatty acid-binding protein) (I-FABP)
Cleaved into：
GeneID：14079
Gene names (primary )：Fabp2
Gene names (synonym )：Fabpi
Gene names (ORF )：
Length：132
Mass：15126
Sequence：MAFDGTWKVDRNENYEKFMEKMGINVMKRKLGAHDNLKLTITQDGNKFTVKESSNFRNIDVVFELGVNFPYSLADGTELTGAWTIEGNKLIGKFTRVDNGKELIAVREVSGNELIQTYTYEGVEAKRFFKKE
Tissue specificity：Expressed in the small intestine. Highest expression levels in the proximal ileum. {ECO:0000269|PubMed:9277406}.
Induction：
Developmental stage：
Protein families：Calycin superfamily, Fatty-acid binding protein (FABP) family