CCL19_MOUSE O70460
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O70460
Recommended name：C-C motif chemokine 19
EC number：
Alternative names：(Epstein-Barr virus-induced molecule 1 ligand chemokine) (EBI1 ligand chemokine) (ELC) (Small-inducible cytokine A19)
Cleaved into：
GeneID：24047
Gene names (primary )：Ccl19
Gene names (synonym )：Elc Scya19
Gene names (ORF )：
Length：108
Mass：11911
Sequence：MAPRVTPLLAFSLLVLWTFPAPTLGGANDAEDCCLSVTQRPIPGNIVKAFRYLLNEDGCRVPAVVFTTLRGYQLCAPPDQPWVDRIIRRLKKSSAKNKGNSTRRSPVS
Tissue specificity：Highly expressed by dendritic cells in mesenteric and peripheral lymph nodes. Significant expression in spleen (T cell zone or periarteriolar lymphatic sheath) and Peyer patches. Low expression in thymus.
Induction：
Developmental stage：
Protein families：Intercrine beta (chemokine CC) family