DFA21_MOUSE   Q8C1P2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8C1P2

Recommended name:Alpha-defensin 21

EC number:

Alternative names:(Defensin-related cryptdin-21)

Cleaved into:

GeneID:66298

Gene names  (primary ):Defa21

Gene names  (synonym ):Defcr21

Gene names  (ORF ):

Length:93

Mass:10507

Sequence:MKTLVLLSALILLAYQVQTDPIQNTDEETNTEEQPGEDDQAVSVSFGGQEGSALHEKLSRDLICLCRNRRCNRGELFYGTCAGPFLRCCRRRR

Tissue specificity:

Induction:

Developmental stage:

Protein families:Alpha-defensin family


   💬 WhatsApp