DFA11_MOUSE   P50709


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P50709

Recommended name:Alpha-defensin 11

EC number:

Alternative names:(Defensin-related cryptdin-11) (Fragment)

Cleaved into:

GeneID:

Gene names  (primary ):Defa11

Gene names  (synonym ):Defcr11

Gene names  (ORF ):

Length:85

Mass:9542

Sequence:ALVLLAFQVQADPIQNTDEETKTEEQPGEEDQAVSVSFGDPEGTSLQEESLRDLVCYCRSRGCKGRERMNGTCRKGHLLYMLCCR

Tissue specificity:Paneth cells of the small bowel.

Induction:

Developmental stage:

Protein families:Alpha-defensin family


   💬 WhatsApp