COMD3_MOUSE   Q63829


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q63829

Recommended name:COMM domain-containing protein 3

EC number:

Alternative names:(Bmi-1 upstream gene protein) (Bup protein)

Cleaved into:

GeneID:12238

Gene names  (primary ):Commd3

Gene names  (synonym ):Bup

Gene names  (ORF ):

Length:195

Mass:22037

Sequence:MELSESVQRGIQTLADPGSFDSNAFALLLRAAFQSLLDARADEAALDHPYLKQIDPVVLKHCHAAAATCILEAGKHQVDKSTLSTYLEDCKFDRERIELFCTEYQNNKNSLETLLGSIGRSLPHITDVSWRLEYQIKTNQLHKMYRPGYLVTLNVENNDSQSYPEINFSCNMEQLQDLVGKLKDASKSLERATQL

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp