CXL14_MOUSE Q9WUQ5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9WUQ5
Recommended name：C-X-C motif chemokine 14
EC number：
Alternative names：(B-cell and monocyte-activating chemokine) (Chemokine BRAK) (Kidney-expressed chemokine CXC) (MIP-2G) (Small-inducible cytokine B14)
Cleaved into：
GeneID：57266
Gene names (primary )：Cxcl14
Gene names (synonym )：Bmac Kec Ks1 Mip2g Scyb14
Gene names (ORF )：
Length：99
Mass：11716
Sequence：MRLLAAALLLLLLALCASRVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIVTTKSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Tissue specificity：Highly expressed in brain, lung, ovary, muscle and in kidney and liver parenchyma, and at lower levels in bone marrow. {ECO:0000269|PubMed:10784614, ECO:0000269|PubMed:10946286}.
Induction：
Developmental stage：
Protein families：Intercrine alpha (chemokine CxC) family