MARE1_MOUSE   Q61166


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q61166

Recommended name:Microtubule-associated protein RP/EB family member 1

EC number:

Alternative names:(APC-binding protein EB1) (End-binding protein 1) (EB1)

Cleaved into:

GeneID:13589

Gene names  (primary ):Mapre1

Gene names  (synonym ):

Gene names  (ORF ):

Length:268

Mass:30016

Sequence:MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKEYDPVAARQGQETAVAPSLVAPALSKPKKPLGSSTAAPQRPIATQRTTAAPKAGPGMVRKNPGVGNGDDEAAELMQQVKVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY

Tissue specificity:Expressed within the midpiece of sperm tail (at protein level). {ECO:0000269|PubMed:23055941}.

Induction:

Developmental stage:

Protein families:MAPRE family


   💬 WhatsApp