ABHGA_MOUSE   Q9Z1Q2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Z1Q2

Recommended name:Phosphatidylserine lipase ABHD16A

EC number:EC 3.1.-.-

Alternative names:(Alpha/beta hydrolase domain-containing protein 16A) (Abhydrolase domain-containing protein 16A) (HLA-B-associated transcript 5) (mBAT5) (Monoacylglycerol lipase ABHD16A) (EC 3.1.1.23)

Cleaved into:

GeneID:193742

Gene names  (primary ):Abhd16a

Gene names  (synonym ):Bat5 Ng26

Gene names  (ORF ):

Length:558

Mass:63086

Sequence:MAKLLSCVLGPRLYKIYRERDTDRAASSVPETPTAVPAASSSSWDTYYQPRALEKHADSILALASVFWSISYYSSPFAFFYLYRKGYLSLSKVVPFSHYAGTLLLLLAGVACLRGIGRWTNPQYRQFITILEATHRNQSAENKRQLANYNFDFRSWPVDFHWEEPSSRKGSRGGPSRRGVALLRPEPLHRGTADTFLNRVKKLPCQITSYLVAHTLGRRMLYPGSVYLLQKALMPVLLQGQARLVEECNGRRAKLLACDGNEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTPLEAGYSVLGWNHPGFAGSTGVPFPQNEANAMDVVVQFAIHRLGFQPQDIVIYAWSIGGFTATWAAMSYPDISAVILDASFDDLVPLALKVMPDSWRALVTRTVRQHLNLNNSEQLCRFQGPVLLVRRTKDEIITTTVPEDIMSNRGNDLLLKLLQFRYPRVMVEEGLRAVRQWLEASSQLEEASIYSRWEVEEDWCVSVLRSYQAEHGPDFPWSVGEDMSADGRRQLALFLARKHLHNFEATHCTPLPAQHFQMPWHL

Tissue specificity:

Induction:

Developmental stage:

Protein families:AB hydrolase superfamily, ABHD16 family


   💬 WhatsApp