SBP2_MOUSE   Q63836


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q63836

Recommended name:Selenium-binding protein 2

EC number:

Alternative names:(56 kDa acetaminophen-binding protein) (AP56)

Cleaved into:

GeneID:20342

Gene names  (primary ):Selenbp2

Gene names  (synonym ):Lpsb2

Gene names  (ORF ):

Length:472

Mass:52610

Sequence:MATKCTKCGPGYPTPLEAMKGPREEIVYLPCIYRNTGTEAPDYLATVDVDPKSPQYSQVIHRLPMPYLKDELHHSGWNTCSSCFGDSTKSRNKLILPGLISSRIYVVDVGSEPRAPKLHKVIEASEIQAKCNVSNTHTSHCLASGEVMVNTLGDLQGNGKGSFVLLDGETFEVKGTWEKPGGASPMGYDFWYQPRHNVMVSTEWAAPNVFKDGFNPAHVEAGLYGSRIFVWDWQRHEIIQTLQMTDGLIPLEIRFLHDPSATQGFVGCALSSNIQRFYKNEEGTWSVEKVIQVPSKKVKGWMLPEMPGLITDILLSLDDRFLYFSNWLHGDIRQYDISNPQKPRLTGQIFLGGSIVRGGSVQVLEDQELTCQPEPLVVKGKRIPGGPQMIQLSLDGKRLYATTSLYSDWDKQFYPDLIREGSVMLQVDVDTVNGGLKLNPNFLVDFGKEPLGPALAHELRYPGGDCSSDIWI

Tissue specificity:Mainly expressed in liver.

Induction:

Developmental stage:

Protein families:Selenium-binding protein family


   💬 WhatsApp