AZI2_MOUSE Q9QYP6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QYP6
Recommended name：5-azacytidine-induced protein 2
EC number：
Alternative names：(NF-kappa-B-activating kinase-associated protein 1) (Nak-associated protein 1)
Cleaved into：
GeneID：27215
Gene names (primary )：Azi2
Gene names (synonym )：Az2 Nap1 Tbkp2
Gene names (ORF )：
Length：405
Mass：46091
Sequence：MDTLVEDDICILNHEKAHRREAVTPLSAYPGDESVASHFALVTAYEDIKKRLKDSEKENSFLKKRIRALEERLVGARADEETSSVGREQVNKAYHAYREVCIDRDNLKNQLEKINKDNSESLKMLNEQLQSKEVELLQLRTEVETQQVMRNLNPPSSSWEVEKLSCDLKIHGLEQELGLLRKECSDLRTELQKARQTGPPQEDILQGRDVIRPSLSREEHVPHQGLHHSDNMQHAYWELKREMSNLHLVTQVQAELLRKLKTSAAVKKACTPVGCVEDLGRDSTKLHLTNFTATYKRHPSLSPNGKAPCYAPSSPLPGDRKVFSDKAVLQSWTDNERLVPNDGADFPEHSSYGRNSLEDNSWVFPSPPKSSETAFGENKSKILPLSNLPPLHYLDQQNQNCLYKS
Tissue specificity：Testis, ovary, heart, lung, kidney and brain. Expressed mainly in the spermatocytes or spermatids in the testis. {ECO:0000269|PubMed:10580148}.
Induction：By 5-azacytidine. {ECO:0000269|PubMed:10580148}.
Developmental stage：
Protein families：