LXN_MOUSE P70202
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P70202
Recommended name：Latexin
EC number：
Alternative names：(Endogenous carboxypeptidase inhibitor) (ECI) (Tissue carboxypeptidase inhibitor) (TCI)
Cleaved into：
GeneID：17035
Gene names (primary )：Lxn
Gene names (synonym )：
Gene names (ORF )：
Length：222
Mass：25492
Sequence：MEIPPTHYAASRAASVAENCINYQQGTPHKLFLVQTVQQASKEDIPGRGHKYHLKFSVEEIIQKQVTVNCTAEVLYPQMGQGSAPEVNFTFEGEIGKNPDEEDNTFYQSLMSLKRPLEAQDIPDNFGNVSPQMKPVQHLAWVACGYVMWQNSTEDTWYKMLKIQTVKQVQRNDDFIELDYTILLHDIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEGQAE
Tissue specificity：Highly enriched in macrophages. {ECO:0000269|PubMed:15698574}.
Induction：By CSF1 and lipopolysaccharides (LPS). {ECO:0000269|PubMed:15698574}.
Developmental stage：
Protein families：Protease inhibitor I47 (latexin) family