BATF2_MOUSE   Q8R1H8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8R1H8

Recommended name:Basic leucine zipper transcriptional factor ATF-like 2

EC number:

Alternative names:(B-ATF-2)

Cleaved into:

GeneID:74481

Gene names  (primary ):Batf2

Gene names  (synonym ):

Gene names  (ORF ):

Length:277

Mass:29703

Sequence:MQLCGSSELLTETDLGESQKQLKKKQKNRVAAQRSRQKHTSKADALHQQHESLEKQNHALRKEIQALQTELAGWGRTLHLHERLCRVDCDPCPVLLPSGCPIQAKQPSGQPAPLGYNGCQEQLGLFQTPGSSPRAQHLSPGPCSHESPGLLPSLLPSLAFDPLMVRTPLAQLSPSPVLSASSPSGSSLLGSFSKLDPLIPSPQDQLAPPQPLRQEQPTSGRLASSDSPAALGPECSQNREHLPALPGSSTHWQKSSVAPSPQALMAFPLLSSAKVHF

Tissue specificity:

Induction:By cytokines in response to infection. By IFN-gamma. {ECO:0000269|PubMed:22992524}.

Developmental stage:

Protein families:BZIP family


   💬 WhatsApp