CXL10_MOUSE P17515
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P17515
Recommended name：C-X-C motif chemokine 10
EC number：
Alternative names：(10 kDa interferon gamma-induced protein) (Gamma-IP10) (IP-10) (C7) (Interferon-gamma induced protein CRG-2) (Small-inducible cytokine B10)
Cleaved into：
GeneID：15945
Gene names (primary )：Cxcl10
Gene names (synonym )：Crg2 Ifi10 Inp10 Scyb10
Gene names (ORF )：
Length：98
Mass：10789
Sequence：MNPSAAVIFCLILLGLSGTQGIPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP
Tissue specificity：Expressed in the spleen, thymus, lymph nodes and liver (PubMed:8145049). Expressed in astrocytes, microglia, and neurons (PubMed:15456824). {ECO:0000269|PubMed:15456824, ECO:0000269|PubMed:8145049}.
Induction：By interferon gamma.
Developmental stage：
Protein families：Intercrine alpha (chemokine CxC) family