DEFB6_MOUSE Q91VD6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91VD6
Recommended name:Beta-defensin 6
EC number:
Alternative names:(BD-6) (mBD-6) (Defensin, beta 6)
Cleaved into:
GeneID:116746
Gene names (primary ):Defb6
Gene names (synonym ):
Gene names (ORF ):
Length:63
Mass:6977
Sequence:MKIHYLLFAFILVMLSPLAAFSQLINSPVTCMSYGGSCQRSCNGGFRLGGHCGHPKIRCCRRK
Tissue specificity:Predominantly expressed in skeletal muscle, also expressed in esophagus, tongue, and trachea. Also expressed in lung when induced by lipopolysaccharide. {ECO:0000269|PubMed:11408484}.
Induction:Expressed constitutively and induced by lipopolysaccharide (LPS).
Developmental stage:
Protein families:Beta-defensin family