TNR6_MOUSE P25446
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P25446
Recommended name：Tumor necrosis factor receptor superfamily member 6
EC number：
Alternative names：(Apo-1 antigen) (Apoptosis-mediating surface antigen FAS) (FASLG receptor) (CD antigen CD95)
Cleaved into：
GeneID：14102
Gene names (primary )：Fas
Gene names (synonym )：Apt1 Tnfrsf6
Gene names (ORF )：
Length：327
Mass：37437
Sequence：MLWIWAVLPLVLAGSQLRVHTQGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNRLWLLTILVLLIPLVFIYRKYRKRKCWKRRQDDPESRTSSRETIPMNASNLSLSKYIPRIAEDMTIQEAKKFARENNIKEGKIDEIMHDSIQDTAEQKVQLLLCWYQSHGKSDAYQDLIKGLKKAECRRTLDKFQDMVQKDLGKSTPDTGNENEGQCLE
Tissue specificity：Detected in various tissues including thymus, liver, lung, heart, and adult ovary. {ECO:0000269|PubMed:1371136}.
Induction：Expression oscillates in a circadian manner in the liver with peak levels seen at CT12. {ECO:0000269|PubMed:23785138}.
Developmental stage：
Protein families：